PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family Nin-like
Protein Properties Length: 815aa    MW: 91899.4 Da    PI: 6.3372
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00330genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK94.66.8e-30541592152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+i+l++l++yF++++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  AA31G00330 541 AEKNITLDVLRQYFAGSLKDAAKNLGVCPTTLKRICRQHGIQRWPSRKIKKV 592
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.336531612IPR003035RWP-RK domain
PfamPF020422.9E-26544592IPR003035RWP-RK domain
SuperFamilySSF542771.45E-21704800No hitNo description
SMARTSM006661.9E-24715798IPR000270PB1 domain
PROSITE profilePS5174526.693715798IPR000270PB1 domain
PfamPF005643.9E-18716797IPR000270PB1 domain
CDDcd064074.20E-38716796No hitNo description
Gene3DG3DSA:3.10.20.2406.1E-19716793No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 815 aa     Download sequence    Send to blast
MDKNSSIAPS MDPTMDTTFM DGLLLEGCWL ETTDASEFLN FTPSTSITPF DPSSFLWSPV  60
QDTSSLSQIY GQDYTERSSL EDHVNLNKRL WIAPSGHGSS VMERLVQAVK HIKDFTSEKG  120
SLIQLWVPVN KGGKRVLTTK EQPFSHDPMS QQLANYREIS VNYNFSAEME DSKDLVGLPG  180
RVFLGEVPEW TPDVRFFKNE EYPRVQHAQN CDIRGTLAIP VFEQGSKICL GVIEVVMTTQ  240
MVKLSPELDS ICRALQAVDL RSTEVPISSS LKGPDFSYQA ALPEIRNLLR CACETHKLPL  300
AQTWVSCLKQ NKTGCRHNDE NYIHCVSTVD DACYIGDQSV REFQEACSEH HLLKGQGVVG  360
EAFLTNGPCF SPDVSSYKKS EYPLAHHATM FGLHGTVAIR LRCTLTGSAD FVLEFFLPKN  420
CRDFEEQRKM LNALSTIMAH VPRNLRTVTE KELEEETLPK IEKTLELQNS SWSGSLTELH  480
QSNSDHLQNV FHGGSSEIGE RNDELDMKGS FDYGKEPSLN ENSTFSSAGF SRITEKKRTK  540
AEKNITLDVL RQYFAGSLKD AAKNLGVCPT TLKRICRQHG IQRWPSRKIK KVGHSLQKIQ  600
RVIDSVQGVS GHLPIDSFYA NFSKLPSQEA SLHTKTFIST QPAKSPVSSC SHSSSCSSET  660
QANNTSTIPK TQDPTPNKTK ESSSVEETKN LQRFPETHGS TQYLSPSTSS QEDEFLRIKV  720
SYEEEKIRFR MRNSRRLKDL LWEIAKRFSI EDVRRYDLKY LDEDNEWVLL RCDDDVEECI  780
DVCRGFPGQT IRLLLQVSSQ NFTERERSSA SGCLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390206.10.0hypothetical protein EUTSA_v10018128mg
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLV4KCL80.0V4KCL8_EUTSA; Uncharacterized protein
STRINGAT1G76350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein